Description
Research Reagent Identity Data
- Product: CJC-1295 (No DAC) + Ipamorelin
- CAS Number: 863288-34-0 / 170851-70-4
- Molecular Formula: C152H252N44O44 / C38H49N9O5
- Molecular Weight: 3367.9 / 711.9 g/mol
- Sequence / Structure: CJC-1295 (No DAC): YADAIFTNSYRKVLAQGARKLLQDIMSRR-NH2 | Ipamorelin: Aib-His-D-2-Nal-D-Phe-Lys-NH2
- Purity: ≥99% (HPLC verified)
- Form: Lyophilized powder
- Storage: -20°C, desiccated, protected from light
- Shelf Life: 24 months unopened
- Batch Number: PO-2026-B004
- Manufacture Date: June 2026
- COA Status: Available — Certificate of Analysis on file
Each batch is accompanied by a Certificate of Analysis (COA) verifying chemical identity, purity, and molecular weight via HPLC and mass spectrometry. To request the full COA for batch PO-2026-B004, contact pureoptionssupport@gmail.com.
For laboratory research use only. This product is strictly for in vitro and non-human research applications. Not for human consumption. Not for medical use. Not for diagnostic use. Not for therapeutic use. Not a dietary supplement. Not FDA approved. Not for veterinary use. Purchasers must be qualified researchers and attest to research-only use at checkout. Purchaser assumes all responsibility for compliance with applicable regulations.






Reviews
There are no reviews yet.