CJC-1295 (No DAC) + Ipamorelin

$55.00

CJC-1295 (No DAC) + Ipamorelin — CAS: 863288-34-0 / 170851-70-4 | Formula: C152H252N44O44 / C38H49N9O5 | MW: 3367.9 / 711.9 g/mol | Purity: ≥99% | For laboratory research use only.

SKU: cjc-1295-ipamorelin
Category:

Description

Research Reagent Identity Data

  • Product: CJC-1295 (No DAC) + Ipamorelin
  • CAS Number: 863288-34-0 / 170851-70-4
  • Molecular Formula: C152H252N44O44 / C38H49N9O5
  • Molecular Weight: 3367.9 / 711.9 g/mol
  • Sequence / Structure: CJC-1295 (No DAC): YADAIFTNSYRKVLAQGARKLLQDIMSRR-NH2 | Ipamorelin: Aib-His-D-2-Nal-D-Phe-Lys-NH2
  • Purity: ≥99% (HPLC verified)
  • Form: Lyophilized powder
  • Storage: -20°C, desiccated, protected from light
  • Shelf Life: 24 months unopened
  • Batch Number: PO-2026-B004
  • Manufacture Date: June 2026
  • COA Status: Available — Certificate of Analysis on file

Each batch is accompanied by a Certificate of Analysis (COA) verifying chemical identity, purity, and molecular weight via HPLC and mass spectrometry. To request the full COA for batch PO-2026-B004, contact pureoptionssupport@gmail.com.

For laboratory research use only. This product is strictly for in vitro and non-human research applications. Not for human consumption. Not for medical use. Not for diagnostic use. Not for therapeutic use. Not a dietary supplement. Not FDA approved. Not for veterinary use. Purchasers must be qualified researchers and attest to research-only use at checkout. Purchaser assumes all responsibility for compliance with applicable regulations.

Reviews

There are no reviews yet.

Be the first to review “CJC-1295 (No DAC) + Ipamorelin”

Your email address will not be published. Required fields are marked *

For laboratory research use only. Not for human consumption. Not FDA approved. Not a dietary supplement. This site does not provide medical advice. These statements have not been evaluated by the FDA. Products are not drugs and are not intended to diagnose, treat, cure, or prevent any disease.